Sortase A

Sortase A can specifically identify the peptide sequence LPXTG. Synthetic peptide 1 (YGVRLCGREFIRAVIF-TCGGSRWRRKGGLPRTGG) and peptide 2 (GGGGSGGRRSRRSRQDLQTLCCTDGCSMTDLSALC) to connect, conduct experiments and tests.
Lane 1 Polypeptide 1;
Lane 2 Polypeptide 2;
Lane 3 Negative Control (negative control with no added enzyme only);
Lane 4 UA-Sortase A: 1 ug;
Lane 5 UA-Sortase A: 2.5 ug;
Lane 6 UA-Sortase A: 4 ug;
Lane 7 UA-Sortase A: 5 ug;

2μg (R: reducing condition, N: non-reducing condition).

98.4%

99.6%